6
[ubuntu] [samba] I can create, rename and modify, but not deleteview story

http://ubuntuforums.org – Hi all First of all I'd like to thank all the helpful members of this forum. A week ago I didn't know anything about linux, and I'm pretty sure that through this forum entirely I've gone on to setup an Ubuntu Server with Samba, which I've set up at the office here. I'm having a strange issue. I've created an Archives folder which I've shared with everyone. (HowTos)

5
Storing o/p of a command to a variableview story

http://www.unix.com – Hi, I have a ftp script there I want to store the o/p of the below command: Code: sftp -b <batch file> user@password cat <batch file> get /remote/file/path/remote_file_name.csv*.gz  /local/path Now the problem is that when I fire this command. (HowTos)

4
Reserve resources (memory and processes)view story

http://www.unix.com – I have a shell script which sets some variables and then calls modules of a program in succession, one by one. Problem is that the script is executed on servers with many users, so sometimes the script starts running, runs for 10 minutes and then breaks due to lack of resources when other users run memory intensive processes. (HowTos)

4
Removing a portion of data in a fileview story

http://www.unix.com – Hi, I have a folder that contains many (multiple) files 1.fasta 2.fasta 3.fasta 4.fasta 5.fasta . . 100's of files Each such file have data in the following format for example: vi 1.fasta Code: Code: >AB_1 MLKKPIIIGVTGGSGGGKTSVSRAILDSFPNARIAMIQHDSYYKDQSHMSFEERVKTNYDHPLAFDTDFM IQQLKELLAGRPVDIPIYDYKKHTRSNTTFRQDPQDVIIVEGILVLEDERLRDLMDIKLFVDTDDDIRII RRIKRDMMERGRSLESIIDQYTSVVKPMYHQFIEPSKRYA (HowTos)

4
-exec cmd in ksh scriptview story

http://www.unix.com – Hi, I discovered the following single-line script works very well to cp a large number of files from a source directory to a destination directory while avoiding the "argument list too large" error: # cpmany - copy large number of files # Takes two parameters - source dir, destination dir # Copies ALL regular files from source dir to destination dir # Does not traverse subdirectories (HowTos)

4
Vim-sessions under Windowsview story

http://vim.wikia.com – ← Older revision Revision as of 15:06, September 16, 2010 Line 12: Line 12: |category2=Windows |category2=Windows }} }} - It's easy to set up [[Windows file associations]] so that double-clicking a file in Windows Explorer will open the file in Vim. However, for some types of file, Vim can do more than just edit the file. (HowTos)

3
File Encryptionview story

http://nixcraft.com – Hi Friends, How to ecrypt / lock any configuration in Linux. means i want to encrypt / lock httpd.conf. Regards, Rocky (HowTos)

3
Wireless signal problemview story

http://crunchbanglinux.org – Hi:I realize this may be a hardware problem, not a software one, but I thought I'd ask the panel anyway:I have a Gateway NV53A laptop. From the start, I've had trouble with the wireless. It works (I'm using it now), but the signal is pathetic. Sometimes it's less than 30 percent, which makes zero sense since it's not a big house. (HowTos)

6
Will #! 10 Alpha 2 be able to seamless update to final release?view story

http://crunchbanglinux.org – I download #! 9.04 last week, and I like it very much. Some people said 9.04 would end support soon, what does that mean? Does that mean I can't get new software from Ubuntu official repo?Is #! 10 currently stable enough for a development desktop?Would it be able to update to a final release ?Thanks. (HowTos)

4
Composite managerview story

http://crunchbanglinux.org – Hello,I'm trying to get some compositing getting on with my Openbox. What I want is some transparency in the menu and titlebars and some shadows. Some effects to play around with would be nice, too. First composite manager I tried was Cairo Composite Manager. (HowTos)

4
[ubuntu] problem printing to network printerview story

http://ubuntuforums.org – I understand this is an internet/wireless forum but thought there would be someone here that could shed some light on this. The HP Laserjet 1018 printer is connected to a networked XP machine that is accessible from the Ubuntu 10.04 machine. (HowTos)

6
iPhone 3G in modemmode, Router/Firewall Distributionview story

http://www.linuxquestions.org – Hey, I want to connect my home network with the iPhone via UMTS to the internet. I'm searching a Router and Firewall Distribution, which is able to use the iPhone in modem-mode to connect to the internet. Does anybody know such a Distro which can realize that? Thanks. sMau (HowTos)